PDB entry 1jny

View 1jny on RCSB PDB site
Description: Crystal structure of Sulfolobus solfataricus elongation factor 1 alpha in complex with GDP
Deposited on 2001-07-26, released 2002-01-23
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-23, with a file datestamp of 2002-01-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.22
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jnyA (A:)
    kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrlk
    eerergvtinltfmrfetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeye
    agmsvegqtrehiilaktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfn
    tnkvrfvpvvapsgdnithksenmkwyngptleeyldqlelppkpvdkplripiqdvysi
    sgvgtvpvgrvesgvlkvgdkivfmpagkvgevrsiethhtkmdkaepgdnigfnvrgve
    kkdikrgdvvghpnnpptvadeftariivvwhptalangytpvlhvhtasvacrvselvs
    kldprtgqeaeknpqflkqgdvaivkfkpikplcvekynefpplgrfamrdmgktvgvgi
    ivdvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnyA (A:)
    kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrlk
    eemrfetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeyeagmsvegqtre
    hiilaktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfntnkvrfvpvva
    psgdnithksenmkwyngptleeyldqlelppkpvdkplripiqdvysisgvgtvpvgrv
    esgvlkvgdkivfmpagkvgevrsiethhtkmdkaepgdnigfnvrgvekkdikrgdvvg
    hpnnpptvadeftariivvwhptalangytpvlhvhtasvacrvselvskldprtgqeae
    knpqflkqgdvaivkfkpikplcvekynefpplgrfamrdmgktvgvgiivdvkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jnyB (B:)
    kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrlk
    eerergvtinltfmrfetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeye
    agmsvegqtrehiilaktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfn
    tnkvrfvpvvapsgdnithksenmkwyngptleeyldqlelppkpvdkplripiqdvysi
    sgvgtvpvgrvesgvlkvgdkivfmpagkvgevrsiethhtkmdkaepgdnigfnvrgve
    kkdikrgdvvghpnnpptvadeftariivvwhptalangytpvlhvhtasvacrvselvs
    kldprtgqeaeknpqflkqgdvaivkfkpikplcvekynefpplgrfamrdmgktvgvgi
    ivdvkpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnyB (B:)
    kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrmr
    fetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeyeagmsvegqtrehiil
    aktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfntnkvrfvpvvapsgd
    nithksenmkwyngptleeyldqlelppkpvdkplripiqdvysisgvgtvpvgrvesgv
    lkvgdkivfmpagkvgevrsiethhtkmdkaepgdnigfnvrgvekkdikrgdvvghpnn
    pptvadeftariivvwhptalangytpvlhvhtasvacrvselvskldprtgqeaeknpq
    flkqgdvaivkfkpikplcvekynefpplgrfamrdmgktvgvgiivdvkpa