PDB entry 1jnn

View 1jnn on RCSB PDB site
Description: Crystal Structure of Fab-Estradiol Complexes
Class: immune system
Keywords: igg fold, antibody-hapten complex, estradiol, immune system
Deposited on 2001-07-24, released 2002-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.211
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: monoclonal anti-estradiol 17e12e5 immunoglobulin gamma-1 chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAK01085 (0-207)
      • see remark 999 (208-213)
    Domains in SCOPe 2.06: d1jnnh1, d1jnnh2
  • Chain 'L':
    Compound: monoclonal anti-estradiol 17e12e5 immunoglobulin kappa chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAK01084 (0-210)
    Domains in SCOPe 2.06: d1jnnl1, d1jnnl2
  • Heterogens: EST

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jnnH (H:)
    evqlqqsgaelvkpgasvrlscsasgfnikdtymfwvkqrpeqgldwigrinpangisky
    dprfqgkatltadtssntaylqldnltsedtavyycaiekdlpwgqgtlvtvsvakttpp
    svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jnnL (L:)
    qivmtqtpaslsasvgetvtitcrasgniynylawyqqkqgkspqllvynaktlvdgvpl
    rfsgsgsgtqyslkinslqpedfgnyychhfwntpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr