PDB entry 1jnk

View 1jnk on RCSB PDB site
Description: the c-jun n-terminal kinase (jnk3s) complexed with mgamp-pnp
Class: transferase
Keywords: transferase, jnk3 map kinase, serine/threonine protein kinase
Deposited on 1998-06-03, released 1999-06-08
The last revision prior to the SCOP 1.73 freeze date was dated 1999-06-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-jun n-terminal kinase
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jnka_
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jnkA (A:)
    mslhflyycseptldvkiafcqgfdkqvdvsyiakhynmskskvdnqfysvevgdstftv
    lkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqthakrayrelvlmkcvnh
    kniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhermsyllyqmlcgikhl
    hsagiihrdlkpsnivvksdctlkildfglartagtsfmmtpyvvtryyrapevilgmgy
    kenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqptvrnyven
    rpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisvddalqhpyin
    vwydpaeveapppqiydkqlderehtieewkeliykevmnseektkngvvkgqpspsgaa
    vns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnkA (A:)
    dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
    akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglasfmmtpyvvtryy
    rapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkk
    lqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakris
    vddalqhpyinvwydpaeveapppqlderehtieewkeliykevmn