PDB entry 1jnh

View 1jnh on RCSB PDB site
Description: crystal structure of fab-estradiol complexes
Deposited on 2001-07-24, released 2002-02-06
The last revision prior to the SCOP 1.63 freeze date was dated 2002-02-06, with a file datestamp of 2002-02-06.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.198
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jnhA (A:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhA (A:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvksspsvtlfpps
    seeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyltlt
    arawerhssyscqvtheghtvekslsaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jnhB (B:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhB (B:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jnhC (C:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhC (C:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvksspsvtlfpps
    seeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyltlt
    arawerhssyscqvtheghtvekslsaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jnhD (D:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhD (D:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1jnhE (E:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhE (E:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvksspsvtlfpps
    seeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyltlt
    arawerhssyscqvtheghtvekslsaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1jnhF (F:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhF (F:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1jnhG (G:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhG (G:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvksspsvtlfpps
    seeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyltlt
    arawerhssyscqvtheghtvekslsaa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jnhH (H:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhH (H:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivp