PDB entry 1jn7

View 1jn7 on RCSB PDB site
Description: Solution Structure of a CCHH mutant of the ninth CCHC Zinc Finger of U-shaped
Class: transcription
Keywords: zinc finger, protein-protein interaction, transcription
Deposited on 2001-07-23, released 2002-09-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: u-shaped transcriptional cofactor
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: U-shaped
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VPQ6 (2-35)
      • cloning artifact (0-1)
      • engineered (31)
    Domains in SCOPe 2.08: d1jn7a1, d1jn7a2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jn7A (A:)
    gsaaevmkkycstcdisfnyvktylahkqfyhknkp