PDB entry 1jn6

View 1jn6 on RCSB PDB site
Description: crystal structure of fab-estradiol complexes
Deposited on 2001-07-23, released 2002-02-06
The last revision prior to the SCOP 1.61 freeze date was dated 2002-02-06, with a file datestamp of 2002-02-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.223
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jn6A (A:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtveksls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn6A (A:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvksspsvtlfpps
    seeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyltlt
    arawerhssyscqvtheghtveksls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jn6B (B:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn6B (B:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivp