PDB entry 1jn3

View 1jn3 on RCSB PDB site
Description: fidelity properties and structure of m282l mutator mutant of dna polymerase: subtle structural changes influence the mechanism of nucleotide discrimination
Deposited on 2001-07-22, released 2001-08-03
The last revision prior to the SCOP 1.67 freeze date was dated 2001-08-03, with a file datestamp of 2001-08-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.215
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jn3A (A:)
    lekirqddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfe
    dfekripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftses
    skqpkllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdq
    yycgvlyftgsdifnknlrahalekgftineytirplgvtgvageplpvdseqdifdyiq
    wryrepkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn3A (A:)
    ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekri
    preemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkl
    lhrvveqlqkvrfitdtlskgetkfmgvcqlpseneyphrridirlipkdqyycgvlyft
    gsdifnknlrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepkdr
    se