PDB entry 1jmz

View 1jmz on RCSB PDB site
Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida with inhibitor
Class: oxidoreductase
Keywords: Amine Dehydrogenase
Deposited on 2001-07-20, released 2002-01-16
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amine Dehydrogenase
    Species: Pseudomonas putida
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jmza1, d1jmza2, d1jmza3, d1jmza4, d1jmza5
  • Chain 'B':
    Compound: Amine Dehydrogenase
    Species: Pseudomonas putida
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jmzb_
  • Chain 'G':
    Compound: Amine Dehydrogenase
    Species: Pseudomonas putida
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jmzg_
  • Heterogens: NI, PND, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jmzA (A:)
    aeqgpsllqnkcmgchipegndtysrishqrktpegwlmsiarmqvmhglqisdddrrtl
    vkyladkqglapsetdgvryamerrlntveqfdtqlsetcgrchsgarvalqrrpakewe
    hlvnfhlgqwpsleyqaqardrdwlpialqqvvpdlakryplesaawaewqkarpkadal
    pgqwafsghmlakgdvrgvmsvtpdqgdtfkvevkgayadgtpfngsgsailyngyewrg
    nvkvgdanlrqvfaaldgemkgrmfeaehdergldftavkegkarllavqpafikagges
    eitlvgsglagkpdlgagvevtevleqtptlvrlkaraaadakpgqrevavgtlkgvnla
    vydkveevkvvpafsiarigengasvpkvqgrfeaeawgkdangqplrigylpaswkvep
    fneravededvkfagkmqadgvfvpggagpnperkmmtnnagnlkviatladggqtgegh
    mivtvqrwnnpplp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmzA (A:)
    eqgpsllqnkcmgchipegndtysrishqrktpegwlmsiarmqvmhglqisdddrrtlv
    kyladkqglapsetdgvryamerrlntveqfdtqlsetcgrchsgarvalqrrpakeweh
    lvnfhlgqwpsleyqaqardrdwlpialqqvvpdlakryplesaawaewqkarpkadalp
    gqwafsghmlakgdvrgvmsvtpdqgdtfkvevkgayadgtpfngsgsailyngyewrgn
    vkvgdanlrqvfaaldgemkgrmfeaehdergldftavkegkarllavqpafikaggese
    itlvgsglagkpdlgagvevtevleqtptlvrlkaraaadakpgqrevavgtlkgvnlav
    ydkveevkvvpafsiarigengasvpkvqgrfeaeawgkdangqplrigylpaswkvepf
    neravededvkfagkmqadgvfvpggagpnperkmmtnnagnlkviatladggqtgeghm
    ivtvqrwnnpplp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jmzB (B:)
    adtgpalkagheymivtnypnnlhvvdvasdtvykscvmpdkfgpgtammapdnrtayvl
    nnhygdiygidldtckntfhanlssvpgevgrsmysfaispdgkevyatvnptqrlndhy
    vvkpprlevfstadgleakpvrtfpmprqvylmraaddgslyvagpdiykmdvktgkytv
    alplrnwnrkgysapdvlyfwphqsprhefsmlytiarfkddkqdpatadllygylsvdl
    ktgkthtqefadltelyftglrspkdpnqiygvlnrlakydlkqrklikaanldhtyycv
    afdkkgdklylggtfndlavfnpdtlekvkniklpggdmstttpqvfir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmzB (B:)
    gpalkagheymivtnypnnlhvvdvasdtvykscvmpdkfgpgtammapdnrtayvlnnh
    ygdiygidldtckntfhanlssvpgevgrsmysfaispdgkevyatvnptqrlndhyvvk
    pprlevfstadgleakpvrtfpmprqvylmraaddgslyvagpdiykmdvktgkytvalp
    lrnwnrkgysapdvlyfwphqsprhefsmlytiarfatadllygylsvdlktgkthtqef
    adltelyftglrspkdpnqiygvlnrlakydlkqrklikaanldhtyycvafdkkgdkly
    lggtfndlavfnpdtlekvkniklpggdmstttpqvfir
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1jmzG (G:)
    msavagctattdpgwevdafggvsslcqpmeadlygcsdpcwwpaqvpdmmstyqdwnaq
    asnsaedwrnlgtvfpkdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmzG (G:)
    avagctattdpgwevdafggvsslcqpmeadlygcsdpcwwpaqvpdmmstyqdwnaqas
    nsaedwrnlgtvfpkdk