PDB entry 1jmz

View 1jmz on RCSB PDB site
Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida with inhibitor
Deposited on 2001-07-20, released 2002-01-16
The last revision prior to the SCOP 1.63 freeze date was dated 2002-03-06, with a file datestamp of 2002-03-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jmzA (A:)
    eqgpsllqnkcmgchipegndtysrishqrktpegwlmsiarmqvmhglqisdddrrtlv
    kyladkqglapsetdgvryamerrlntveqfdtqlsetcgrchsgarvalqrrpakeweh
    lvnfhlgqwpsleyqaqardrdwlpialqqvvpdlakryplesaawaewqkarpkadalp
    gqwafsghmlakgdvrgvmsvtpdqgdtfkvevkgayadgtpfngsgsailyngyewrgn
    vkvgdanlrqvfaaldgemkgrmfeaehdergldftavkegkarllavqpafikaggese
    itlvgsglagkpdlgagvevtevleqtptlvrlkaraaadakpgqrevavgtlkgvnlav
    ydkveevkvvpafsiarigengasvpkvqgrfeaeawgkdangqplrigylpaswkvepf
    neravededvkfagkmqadgvfvpggagpnperkmmtnnagnlkviatladggqtgeghm
    ivtvqrwnnpplp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jmzB (B:)
    gpalkagheymivtnypnnlhvvdvasdtvykscvmpdkfgpgtammapdnrtayvlnnh
    ygdiygidldtckntfhanlssvpgevgrsmysfaispdgkevyatvnptqrlndhyvvk
    pprlevfstadgleakpvrtfpmprqvylmraaddgslyvagpdiykmdvktgkytvalp
    lrnwnrkgysapdvlyfwphqsprhefsmlytiarfkddkqdpatadllygylsvdlktg
    kthtqefadltelyftglrspkdpnqiygvlnrlakydlkqrklikaanldhtyycvafd
    kkgdklylggtfndlavfnpdtlekvkniklpggdmstttpqvfir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmzB (B:)
    gpalkagheymivtnypnnlhvvdvasdtvykscvmpdkfgpgtammapdnrtayvlnnh
    ygdiygidldtckntfhanlssvpgevgrsmysfaispdgkevyatvnptqrlndhyvvk
    pprlevfstadgleakpvrtfpmprqvylmraaddgslyvagpdiykmdvktgkytvalp
    lrnwnrkgysapdvlyfwphqsprhefsmlytiarfatadllygylsvdlktgkthtqef
    adltelyftglrspkdpnqiygvlnrlakydlkqrklikaanldhtyycvafdkkgdkly
    lggtfndlavfnpdtlekvkniklpggdmstttpqvfir
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jmzG (G:)
    avagctattdpgwevdafggvsslcqpmeadlygcsdpcwxpaqvpdmmstyqdwnaqas
    nsaedwrnlgtvfpkdk