PDB entry 1jmx

View 1jmx on RCSB PDB site
Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida
Class: oxidoreductase
Keywords: Amine Dehydrogenase, OXIDOREDUCTASE
Deposited on 2001-07-20, released 2002-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amine Dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jmxa1, d1jmxa2, d1jmxa3, d1jmxa4, d1jmxa5
  • Chain 'B':
    Compound: Amine Dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jmxb_
  • Chain 'G':
    Compound: Amine Dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jmxg_
  • Heterogens: NI, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jmxA (A:)
    aeqgpsllqnkcmgchipegndtysrishqrktpegwlmsiarmqvmhglqisdddrrtl
    vkyladkqglapsetdgvryamerrlntveqfdtqlsetcgrchsgarvalqrrpakewe
    hlvnfhlgqwpsleyqaqardrdwlpialqqvvpdlakryplesaawaewqkarpkadal
    pgqwafsghmlakgdvrgvmsvtpdqgdtfkvevkgayadgtpfngsgsailyngyewrg
    nvkvgdanlrqvfaaldgemkgrmfeaehdergldftavkegkarllavqpafikagges
    eitlvgsglagkpdlgagvevtevleqtptlvrlkaraaadakpgqrevavgtlkgvnla
    vydkveevkvvpafsiarigengasvpkvqgrfeaeawgkdangqplrigylpaswkvep
    fneravededvkfagkmqadgvfvpggagpnperkmmtnnagnlkviatladggqtgegh
    mivtvqrwnnpplp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmxA (A:)
    eqgpsllqnkcmgchipegndtysrishqrktpegwlmsiarmqvmhglqisdddrrtlv
    kyladkqglapsetdgvryamerrlntveqfdtqlsetcgrchsgarvalqrrpakeweh
    lvnfhlgqwpsleyqaqardrdwlpialqqvvpdlakryplesaawaewqkarpkadalp
    gqwafsghmlakgdvrgvmsvtpdqgdtfkvevkgayadgtpfngsgsailyngyewrgn
    vkvgdanlrqvfaaldgemkgrmfeaehdergldftavkegkarllavqpafikaggese
    itlvgsglagkpdlgagvevtevleqtptlvrlkaraaadakpgqrevavgtlkgvnlav
    ydkveevkvvpafsiarigengasvpkvqgrfeaeawgkdangqplrigylpaswkvepf
    neravededvkfagkmqadgvfvpggagpnperkmmtnnagnlkviatladggqtgeghm
    ivtvqrwnnpplp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jmxB (B:)
    adtgpalkagheymivtnypnnlhvvdvasdtvykscvmpdkfgpgtammapdnrtayvl
    nnhygdiygidldtckntfhanlssvpgevgrsmysfaispdgkevyatvnptqrlndhy
    vvkpprlevfstadgleakpvrtfpmprqvylmraaddgslyvagpdiykmdvktgkytv
    alplrnwnrkgysapdvlyfwphqsprhefsmlytiarfkddkqdpatadllygylsvdl
    ktgkthtqefadltelyftglrspkdpnqiygvlnrlakydlkqrklikaanldhtyycv
    afdkkgdklylggtfndlavfnpdtlekvkniklpggdmstttpqvfir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmxB (B:)
    gpalkagheymivtnypnnlhvvdvasdtvykscvmpdkfgpgtammapdnrtayvlnnh
    ygdiygidldtckntfhanlssvpgevgrsmysfaispdgkevyatvnptqrlndhyvvk
    pprlevfstadgleakpvrtfpmprqvylmraaddgslyvagpdiykmdvktgkytvalp
    lrnwnrkgysapdvlyfwphqsprhefsmlytiarfatadllygylsvdlktgkthtqef
    adltelyftglrspkdpnqiygvlnrlakydlkqrklikaanldhtyycvafdkkgdkly
    lggtfndlavfnpdtlekvkniklpggdmstttpqvfir
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1jmxG (G:)
    msavagctattdpgwevdafggvsslcqpmeadlygcsdpcwwpaqvpdmmstyqdwnaq
    asnsaedwrnlgtvfpkdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmxG (G:)
    avagctattdpgwevdafggvsslcqpmeadlygcsdpcwwpaqvpdmmstyqdwnaqas
    nsaedwrnlgtvfpkdk