PDB entry 1jms

View 1jms on RCSB PDB site
Description: Crystal Structure of the Catalytic Core of Murine Terminal Deoxynucleotidyl Transferase
Class: transferase
Keywords: polymerase, nucleotidyl transferase
Deposited on 2001-07-19, released 2002-01-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.214
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: terminal deoxynucleotidyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: TDT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1jmsa1, d1jmsa3, d1jmsa4
  • Heterogens: MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jmsA (A:)
    nsspspvpgsqnvpapavkkisqyacqrrttlnnynqlftdaldilaendelrenegscl
    afmrassvlkslpfpitsmkdtegipclgdkvksiiegiiedgesseakavlnderyksf
    klftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeae
    avsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfw
    kqqglllycdilestfekfkqpsrkvdaldhfqkcflilkldhgrvhseksgqqegkgwk
    airvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtkrvfleae
    seeeifahlgldyiepwerna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmsA (A:)
    kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
    mkdtegipclgdkvksiiegiiedgesseakavlnderyksfklftsvfgvglktaekwf
    rmgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeaeavsmlvkeavvtflpdal
    vtmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfwkqqglllycdilestfek
    fkqpsrkvdaldhfqkcflilkldhgrvhseksegkgwkairvdlvmcpydrrafallgw
    tgsrqferdlrryatherkmmldnhalydrtkrvfleaeseeeifahlgldyiepwerna