PDB entry 1jms

View 1jms on RCSB PDB site
Description: Crystal Structure of the Catalytic Core of Murine Terminal Deoxynucleotidyl Transferase
Deposited on 2001-07-19, released 2002-01-23
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-13, with a file datestamp of 2002-02-13.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.214
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jmsA (A:)
    kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
    mkdtegipclgdkvksiiegiiedgesseakavlnderyksfklftsvfgvglktaekwf
    rmgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeaeavsmlvkeavvtflpdal
    vtmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfwkqqglllycdilestfek
    fkqpsrkvdaldhfqkcflilkldhgrvhseksgqqegkgwkairvdlvmcpydrrafal
    lgwtgsrqferdlrryatherkmmldnhalydrtkrvfleaeseeeifahlgldyiepwe
    rna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmsA (A:)
    kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
    mkdtegipclgdkvksiiegiiedgesseakavlnderyksfklftsvfgvglktaekwf
    rmgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeaeavsmlvkeavvtflpdal
    vtmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfwkqqglllycdilestfek
    fkqpsrkvdaldhfqkcflilkldhgrvhseksegkgwkairvdlvmcpydrrafallgw
    tgsrqferdlrryatherkmmldnhalydrtkrvfleaeseeeifahlgldyiepwerna