PDB entry 1jm7

View 1jm7 on RCSB PDB site
Description: solution structure of the brca1/bard1 ring-domain heterodimer
Deposited on 2001-07-17, released 2001-10-03
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-03, with a file datestamp of 2001-10-03.
Experiment type: NMR14
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jm7a_
  • Chain 'B':
    Domains in SCOP 1.59: d1jm7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jm7A (A:)
    mdlsalrveevqnvinamqkilecpiclelikepvstkcdhifckfcmlkllnqkkgpsq
    cplcknditkrslqestrfsqlveellkiicafqldtgleyan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jm7B (B:)
    mepdgrgawahsraaldrlekllrcsrctnilrepvclggcehifcsncvsdcigtgcpv
    cytpawiqdlkinrqldsmiqlcsklrnllhdnelsd