PDB entry 1jm4

View 1jm4 on RCSB PDB site
Description: NMR Structure of P/CAF Bromodomain in Complex with HIV-1 Tat Peptide
Class: transferase
Keywords: Bromodomain, Protein-peptide Complex, TRANSFERASE
Deposited on 2001-07-17, released 2002-07-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: HIV-1 Tat Peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1JM4 (0-10)
• Chain 'B':
  Compound: P300/CBP-associated Factor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92831 (4-117)
    • cloning artifact (0-3)
  Domains in SCOPe 2.01: d1jm4b_

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jm4B (B:)
  gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
  erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk