PDB entry 1jm1

View 1jm1 on RCSB PDB site
Description: Crystal structure of the soluble domain of the Rieske protein II (soxF) from Sulfolobus acidocaldarius
Class: electron transport, oxidoreductase
Keywords: Rieske iron-sulfur protein, electron transport, respiratory chain, oxidoreductase
Deposited on 2001-07-17, released 2002-07-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.11 Å
R-factor: 0.106
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rieske iron-sulfur protein soxF
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Gene: SOXF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jm1a_
  • Heterogens: MG, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jm1A (A:)
    adntdglagfprykvaniqqvqqqikssgcavyffaypltdepcflvdlqaltgqqitei
    pnpyygkyagplgqiqtikgvgpngtifafsdvcvhlgcqlpaqvivssesdpglyakga
    dlhcpchgsiyalkdggvvvsgpaprplpivildydsstgdiyavgtnapyfsagiprtt
    pqdnllydprysysvpnnpscsng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jm1A (A:)
    ntdglagfprykvaniqqvqqqikssgcavyffaypltdepcflvdlqaltgqqiteipn
    pyygkyagplgqiqtikgvgpngtifafsdvcvhlgcqlpaqvivssesdpglyakgadl
    hcpchgsiyalkdggvvvsgpaprplpivildydsstgdiyavgtnapyfsagiprttpq
    dnllydprysysvpnnpscsng