PDB entry 1jm1

View 1jm1 on RCSB PDB site
Description: Crystal structure of the soluble domain of the Rieske protein II (soxF) from Sulfolobus acidocaldarius
Deposited on 2001-07-17, released 2002-07-17
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-17, with a file datestamp of 2002-07-17.
Experiment type: XRAY
Resolution: 1.11 Å
R-factor: 0.106
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1jm1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jm1A (A:)
    ntdglagfprykvaniqqvqqqikssgcavyffaypltdepcflvdlqaltgqqiteipn
    pyygkyagplgqiqtikgvgpngtifafsdvcvhlgcqlpaqvivssesdpglyakgadl
    hcpchgsiyalkdggvvvsgpaprplpivildydsstgdiyavgtnapyfsagiprttpq
    dnllydprysysvpnnpscsng