PDB entry 1jlw

View 1jlw on RCSB PDB site
Description: Anopheles dirus species B glutathione S-transferases 1-4
Class: transferase
Keywords: glutathione S-transferase, GST, AdGST1-4
Deposited on 2001-07-16, released 2002-07-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.223
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione transferase GST1-4
    Species: Anopheles cracens [TaxId:123217]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1jlwa1, d1jlwa2
  • Chain 'B':
    Compound: glutathione transferase GST1-4
    Species: Anopheles cracens [TaxId:123217]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1jlwb1, d1jlwb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jlwA (A:)
    mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
    fvlwesraiqiylvekygahdadlaerlypsdprrravvhqrlffdvavlyqrfaeyyyp
    qifgqkvpvgdpgrlrsmeqaleflntflegeqyvaggddptiadlsilatiatyevagy
    dlrryenvqrwyertsaivpgadknvegakvfgryftqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jlwA (A:)
    mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
    fvlwesraiqiylvekygahdadlaerlypsdprrravvhqrlffdvavlyqrfaeyyyp
    qifgqkvpvgdpgrlrsmeqaleflntflegeqyvaggddptiadlsilatiatyevagy
    dlrryenvqrwyertsaivpgadknvegakvfgryft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jlwB (B:)
    mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
    fvlwesraiqiylvekygahdadlaerlypsdprrravvhqrlffdvavlyqrfaeyyyp
    qifgqkvpvgdpgrlrsmeqaleflntflegeqyvaggddptiadlsilatiatyevagy
    dlrryenvqrwyertsaivpgadknvegakvfgryftqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jlwB (B:)
    mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
    fvlwesraiqiylvekygahdadlaerlypsdprrravvhqrlffdvavlyqrfaeyyyp
    qifgqkvpvgdpgrlrsmeqaleflntflegeqyvaggddptiadlsilatiatyevagy
    dlrryenvqrwyertsaivpgadknvegakvfgryft