PDB entry 1jlw

View 1jlw on RCSB PDB site
Description: Anopheles dirus species B glutathione S-transferases 1-4
Deposited on 2001-07-16, released 2002-07-16
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-16, with a file datestamp of 2002-07-16.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.223
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jlwA (A:)
    mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
    fvlwesraiqiylvekygahdadlaerlypsdprrravvhqrlffdvavlyqrfaeyyyp
    qifgqkvpvgdpgrlrsmeqaleflntflegeqyvaggddptiadlsilatiatyevagy
    dlrryenvqrwyertsaivpgadknvegakvfgryft
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jlwB (B:)
    mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
    fvlwesraiqiylvekygahdadlaerlypsdprrravvhqrlffdvavlyqrfaeyyyp
    qifgqkvpvgdpgrlrsmeqaleflntflegeqyvaggddptiadlsilatiatyevagy
    dlrryenvqrwyertsaivpgadknvegakvfgryft