PDB entry 1jl9

View 1jl9 on RCSB PDB site
Description: Crystal Structure of Human Epidermal Growth Factor
Class: signaling protein
Keywords: Dimerization, Growth factor
Deposited on 2001-07-16, released 2001-10-24
The last revision prior to the SCOP 1.75 freeze date was dated 2007-06-26, with a file datestamp of 2007-06-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.231
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epidermal growth factor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jl9a_
  • Chain 'B':
    Compound: epidermal growth factor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jl9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1jl9A (A:)
nsdsecplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwe

    Sequence, based on observed residues (ATOM records): (download) 
    >1jl9A (A:)
cplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdl

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1jl9B (B:)
nsdsecplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwe

    Sequence, based on observed residues (ATOM records): (download) 
    >1jl9B (B:)
cplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkww