PDB entry 1jl6

View 1jl6 on RCSB PDB site
Description: Crystal Structure of CN-Ligated Component IV Glycera Dibranchiata Monomeric Hemoglobin
Class: oxygen storage/transport
Keywords: Glycera, monomer hemoglobin
Deposited on 2001-07-16, released 2002-07-16
The last revision prior to the SCOP 1.75 freeze date was dated 2002-09-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.179
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monomer hemoglobin component IV
    Species: Glycera dibranchiata
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jl6a_
  • Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jl6A (A:)
glsaaqrqvvastwkdiagsdngagvgkecftkflsahhdmaavfgfsgasdpgvadlga
kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
kmnaaakdawaaayadisgalisglqs