PDB entry 1jkt

View 1jkt on RCSB PDB site
Description: tetragonal crystal form of a catalytic domain of death-associated protein kinase
Class: transferase
Keywords: transferase
Deposited on 2001-07-13, released 2002-04-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.273
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: death-associated protein kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jkta_
  • Chain 'B':
    Compound: death-associated protein kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jktb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jktA (A:)
    tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
    erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
    qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
    sntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalssawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jktA (A:)
    tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
    erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
    qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
    sntsalakdfirrllvkdpkkrmtiqdslqhpwikp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jktB (B:)
    tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
    erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
    qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
    sntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalssawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jktB (B:)
    tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
    erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
    qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
    sntsalakdfirrllvkdpkkrmtiqdslqhpwikp