PDB entry 1jkc

View 1jkc on RCSB PDB site
Description: human lysozyme mutant with trp 109 replaced by phe
Class: lysozyme
Keywords: hydrolase, muramidase, hydrolase (o-glycosyl), glycosidase
Deposited on 1996-11-13, released 1997-05-15
The last revision prior to the SCOP 1.73 freeze date was dated 1997-05-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.18
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS
    Gene: A SYNTHETIC GENE OF HUMAN LYSO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (108)
    Domains in SCOP 1.73: d1jkca_
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkcA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirafvawrnrcqnrd
    vrqyvqgcgv