PDB entry 1jka

View 1jka on RCSB PDB site
Description: human lysozyme mutant with glu 35 replaced by asp
Deposited on 1996-11-13, released 1997-05-15
The last revision prior to the SCOP 1.57 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.178
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1jka__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jka_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwdsgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv