PDB entry 1jk8

View 1jk8 on RCSB PDB site
Description: Crystal structure of a human insulin peptide-HLA-DQ8 complex
Class: immune system
Keywords: HLA-DQ8, insulin B peptide, type 1 diabetes, autoimmunity, IMMUNE SYSTEM
Deposited on 2001-07-11, released 2001-08-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.224
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II HLA-DQ8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1jk8a1, d1jk8a2
  • Chain 'B':
    Compound: MHC class II HLA-DQ8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1jk8b1, d1jk8b2
  • Chain 'C':
    Compound: insulin B peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB CAA08766 (0-13)
      • conflict (13)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jk8A (A:)
vadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfal
tniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvvnit
wlsnghsvtegvsetsflsksdhsffkisyltflpsddeiydckvehwgldepllkhwep
e

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jk8B (B:)
spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
sqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsrtealnhhnllvcsvtdf
ypaqikvrwfrndqeettgvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqn
piivewraqs

  • Chain 'C':
    No sequence available.