PDB entry 1jk8

View 1jk8 on RCSB PDB site
Description: crystal structure of a human insulin peptide-hla-dq8 complex
Deposited on 2001-07-11, released 2001-08-22
The last revision prior to the SCOP 1.65 freeze date was dated 2001-08-22, with a file datestamp of 2001-08-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.224
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jk8A (A:)
    vadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfal
    tniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvvnit
    wlsnghsvtegvsetsflsksdhsffkisyltflpsddeiydckvehwgldepllkhwep
    e
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jk8B (B:)
    spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
    sqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsrtealnhhnllvcsvtdf
    ypaqikvrwfrndqeettgvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqn
    piivewraqs