PDB entry 1jk3

View 1jk3 on RCSB PDB site
Description: Crystal structure of human MMP-12 (Macrophage Elastase) at true atomic resolution
Class: hydrolase
Keywords: Matrix metalloproteinase, batimastat, bb94, hydroxamic acid, MMP12, elastase, complex (elastase-inhibitor), metallo elastase, HYDROLASE
Deposited on 2001-07-11, released 2001-09-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: 0.169
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Macrophage metalloelastase
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39900 (0-157)
    • engineered (113)
  Domains in SCOPe 2.04: d1jk3a_
• Heterogens: ZN, CA, BAT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jk3A (A:)
  gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
  gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhaighslg
  lghssdpkavmfptykyvdintfrlsaddirgiqslyg