PDB entry 1jk0

View 1jk0 on RCSB PDB site
Description: Ribonucleotide reductase Y2Y4 heterodimer
Class: oxidoreductase
Keywords: ribonucleotide reductase, R2, OXIDOREDUCTASE
Deposited on 2001-07-10, released 2001-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.243
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonucleoside-diphosphate reductase small chain 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RNR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jk0a_
  • Chain 'B':
    Compound: ribonucleoside-diphosphate reductase small chain 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RNR4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jk0b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jk0A (A:)
    mgsshhhhhhssglvprgshmpketpskaaadalsdleikdsksnlnkeletlreenrvk
    sdmlkeklskdaenhkaylkshqvhrhklkemekeepllnedkertvlfpikyheiwqay
    kraeasfwtaeeidlskdihdwnnrmnenerffisrvlaffaasdgivnenlvenfstev
    qipeaksfygfqimienihsetysllidtyikdpkeseflfnaihtipeigekaewalrw
    iqdadalfgerlvafasiegvffsgsfasifwlkkrgmmpgltfsnelicrdeglhtdfa
    cllfahlknkpdpaivekivteaveieqryfldalpvallgmnadlmnqyvefvadrllv
    afgnkkyykvenpfdfmenislagktnffekrvsdyqkagvmskstkqeagaftfnedf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jk0A (A:)
    lnkeletlreenrvksdmlkeklskdaenhkaylkshqvhrhklkemekeepllnedker
    tvlfpikyheiwqaykraeasfwtaeeidlskdihdwnnrmnenerffisrvlaffaasd
    givnenlvenfstevqipeaksfygfqimienihsetysllidtyikdpkeseflfnaih
    tipeigekaewalrwiqdadalfgerlvafasiegvffsgsfasifwlkkrgmmpgltfs
    nelicrdeglhtdfacllfahlknkpdpaivekivteaveieqryfldalpvallgmnad
    lmnqyvefvadrllvafgnkkyykvenpfdfmen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jk0B (B:)
    meahnqflktfqkerhdmkeaekdeillmensrrfvmfpikyheiwaaykkveasfwtae
    eielakdtedfqkltddqktyignllalsissdnlvnkylienfsaqlqnpegksfygfq
    immeniysevysmmvdaffkdpkniplfkeianlpevkhkaafierwisnddslyaerlv
    afaakegifqagnyasmfwltdkkimpglamanrnicrdrgaytdfscllfahlrtkpnp
    kiiekiiteaveiekeyysnslpvekfgmdlksihtyiefvadgllqgfgnekyynavnp
    fefmedvatagkttffekkvsdyqkasdmsksatpskeinfdddf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jk0B (B:)
    fqkerhdmkeaekdeillmensrrfvmfpikyheiwaaykkveasfwtaeeielakdted
    fqkltddqktyignllalsilienfsaqlqnpegksfygfqimmeniysevysmmvdaff
    kdpkniplfkeianlpevkhkaafierwisnddslyaerlvafaakegifqagnyasmfw
    ltdkkimpglamanrnicrdrgaytdfscllfahlrtkpnpkiiekiiteaveiekeyys
    nslphtyiefvadgllqgfgnekyy