PDB entry 1jjy

View 1jjy on RCSB PDB site
Description: crystal structure of a ni-containing carbon monoxide dehydrogenase from carboxydothermus hydrogenoformans
Deposited on 2001-07-10, released 2001-08-22
The last revision prior to the SCOP 1.65 freeze date was dated 2001-08-22, with a file datestamp of 2001-08-22.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.161
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1jjya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jjyA (A:)
    makqnlkstdravqqmldkakregiqtvwdryeamkpqcgfgetglccrhclqgpcrinp
    fgdepkvgicgataevivargldrsiaagaaghsghakhlahtlkkavqgkaasymikdr
    tklhsiakrlgiptegqkdedialevakaaladfhekdtpvlwvttvlppsrvkvlsahg
    lipagidheiaeimhrtsmgcdadaqnlllgglrcsladlagcymgtdladilfgtpapv
    vtesnlgvlkadavnvavhghnpvlsdiivsvskemenearaagatginvvgicctgnev
    lmrhgipacthsvsqemamitgaldamildyqciqpsvatiaectgttvittmemskitg
    athvnfaeeaavenakqilrlaidtfkrrkgkpveipniktkvvagfsteaiinalskln
    andplkplidnvvngnirgvclfagcnnvkvpqdqnfttiarkllkqnvlvvatgcgaga
    lmrhgfmdpanvdelcgdglkavltaigeanglggplppvlhmgscvdnsrsvalvaala
    nrlgvdmdrlpvvasaaqamhekavaigtwavtiglpthigvfppitgslpvtqiltssv
    kditggyfiveldpqvaadkllaainerraglglpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjyA (A:)
    qnlkstdravqqmldkakregiqtvwdryeamkpqcgfgetglccrhclqgpcrinpfgd
    epkvgicgataevivargldrsiaagaaghsghakhlahtlkkavqgkaasymikdrtkl
    hsiakrlgiptegqkdedialevakaaladfhekdtpvlwvttvlppsrvkvlsahglip
    agidheiaeimhrtsmgcdadaqnlllgglrcsladlagcymgtdladilfgtpapvvte
    snlgvlkadavnvavhghnpvlsdiivsvskemenearaagatginvvgicctgnevlmr
    hgipacthsvsqemamitgaldamildyqciqpsvatiaectgttvittmemskitgath
    vnfaeeaavenakqilrlaidtfkrrkgkpveipniktkvvagfsteaiinalsklnand
    plkplidnvvngnirgvclfagcnnvkvpqdqnfttiarkllkqnvlvvatgcgagalmr
    hgfmdpanvdelcgdglkavltaigeanglggplppvlhmgscvdnsrsvalvaalanrl
    gvdmdrlpvvasaaqamhekavaigtwavtiglpthigvfppitgslpvtqiltssvkdi
    tggyfiveldpqvaadkllaainerraglglpr