PDB entry 1jju

View 1jju on RCSB PDB site
Description: Structure of a Quinohemoprotein Amine Dehydrogenase with a Unique Redox Cofactor and Highly Unusual Crosslinking
Class: electron transport protein
Keywords: quinohemoprotein, amine dehydrogenase
Deposited on 2001-07-09, released 2001-12-12
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.202
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinohemoprotein amine dehydrogenase
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jjua1, d1jjua2, d1jjua3, d1jjua4, d1jjua5
  • Chain 'B':
    Compound: quinohemoprotein amine dehydrogenase
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jjub_
  • Chain 'C':
    Compound: quinohemoprotein amine dehydrogenase
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jjuc_
  • Heterogens: NA, HEM, TBU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jjuA (A:)
    vtgeevlqnacaachvqhedgrweridaarktpegwdmtvtrmmrnhgvalepeeraaiv
    rhlsdtrglslaeteerryilerepvawdegpdtsmtqtcgrchsyarvalqrrtpedwk
    hlvnfhlgqfptleyqalardrdwwgiaqaeiipflartyplgeapdayaddasgayvla
    grqpgrgdytgrlvlkkagedyevtmtldfadgsrsfsgtgrilgagewratlsdgtvti
    rqifalqdgrfsgrwhdadsdviggrlaavkadaapqvlavaparlkigeetqlrvagtg
    lgsdltlpegvagsvesagngvtvlkltatgtpgpvslelggqkvdlvaydrpdrisivp
    dltiariggnggpipkvpaqfeamgwlngpdgqpgtgddialgafpaswatdnfdeeaek
    mqdakyagsiddtglftpaeagpnperpmqtnnagnlkviatvdaegeplsaeahlyatv
    qrfvdapir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jjuB (B:)
    rdyilaparpdklvvidtekmavdkvitiadagptpmvpmvapggriayatvnkseslvk
    idlvtgetlgridlstpeervkslfgaalspdgktlaiyespvrlelthfevqptrvaly
    daetlsrrkafeaprqitmlawardgsklyglgrdlhvmdpeagtlvedkpiqsweaety
    aqpdvlavwnqhessgvmatpfytarkdidpadptayrtglltmdletgemamrevrimd
    vfyfstavnpaktrafgaynvlesfdleknasikrvplphsyysvnvstdgstvwlggal
    gdlaaydaetlekkgqvdlpgnasmslasvrlftrde
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jjuC (C:)
    mnalvgcttsfdpgwevdafgavsnlcqpmeadlygcadpcwwpaqvadtlntypnwsag
    addvmqdwrklqsvfpetk