PDB entry 1jjg

View 1jjg on RCSB PDB site
Description: Solution Structure of Myxoma Virus Protein M156R
Class: Viral protein
Keywords: beta barrel, S1 motif, OB Fold, MYXV156R, NESG PROJECT, STRUCTURAL GENOMICS, EIF-2a HOMOLOG, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, Viral protein
Deposited on 2001-07-05, released 2002-03-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: m156r
    Species: Myxoma virus (strain Lausanne) [TaxId:31530]
    Gene: M156R
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jjga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jjgA (A:)
    mtvikpssrprprknknikvntyrtsamdlspgsvhegivyfkdgifkvrllgyegheci
    lldylnyrqdtldrlkerlvgrviktrvvradglyvdlrrff