PDB entry 1jiz

View 1jiz on RCSB PDB site
Description: Crystal Structure Analysis of human Macrophage Elastase MMP-12
Class: hydrolase
Keywords: matrix metalloproteinase, MMP-12, chronic obstructive pulmonary disease, HYDROLASE
Deposited on 2001-07-03, released 2002-07-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.197
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage elastase MMP-12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-165)
      • cloning artifact (0)
    Domains in SCOPe 2.04: d1jiza_
  • Chain 'B':
    Compound: macrophage elastase MMP-12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-165)
      • cloning artifact (0)
    Domains in SCOPe 2.04: d1jizb_
  • Heterogens: ZN, CA, CGS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jizA (A:)
gfrempggpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmad
ilvvfargahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavh
eighslglghssdpkavmfptykyvdintfrlsaddirgiqslygd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jizB (B:)
gfrempggpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmad
ilvvfargahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavh
eighslglghssdpkavmfptykyvdintfrlsaddirgiqslygd