PDB entry 1jiw

View 1jiw on RCSB PDB site
Description: Crystal structure of the APR-APRin complex
Class: hydrolase/hyrolase inhibitor
Keywords: Pseudomonas aeruginosa alkaline protease inhibitor, HYDROLASE/HYROLASE INHIBITOR COMPLEX
Deposited on 2001-07-03, released 2001-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.184
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: proteinase inhibitor
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jiwi_
  • Chain 'P':
    Compound: alkaline metalloproteinase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jiwp1, d1jiwp2
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1jiwI (I:)
    sslillsasdlagqwtlqqdeapaichlelrdsevaeasgydlggdtacltrwlpsepra
    wrptpagiallerggltlmllgrqgegdyrvqkgdggqlvlrratp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jiwI (I:)
    sslillsasdlagqwtlqqdeapaichlelrdsevaeasgydlggdtacltrwlpsepra
    wrptpagiallerggltlmllgrqgegdyrvqkgdggqlvlrrat
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jiwP (P:)
    grsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapgdsvltlsys
    fltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihfvdagqgdqg
    dltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygrqtltheigh
    tlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgayssapllddia
    aiqklyganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqn
    qkinlnekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilyg
    glgadqlwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyv
    dafagkagqailsydaaskagslaidfsgdahadfainligqatqadivv