PDB entry 1jih

View 1jih on RCSB PDB site
Description: Yeast DNA Polymerase ETA
Class: translation
Keywords: DNA Polymerase, translesion, yeast, TRANSLATION
Deposited on 2001-07-02, released 2002-01-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.215
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA Polymerase ETA
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RAD30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jiha1, d1jiha2
  • Chain 'B':
    Compound: DNA Polymerase ETA
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RAD30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jihb1, d1jihb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jihA (A:)
    mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
    avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
    vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd
    lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
    gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
    eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
    nidplktadlaeklfklsrgryglplssrpvvksmmsnknlrgkscnsivdciswlevfc
    aeltsriqdleqeynkiviprtvsislktksyevyrksgpvaykginfqshellkvgikf
    vtdldikgknksyypltklsmtitnfdiidlqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jihA (A:)
    mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
    avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
    vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd
    lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
    gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
    eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
    nidplktadlaeklfklsrgryglplssrpvvksmmsnknlrgkscnsivdciswlevfc
    aeltsriqdleqeynkiviprtvsislktksyevyrksgpvaykginfqshellkvgikf
    vtdldikgknksyypltklsmtitnfdii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jihB (B:)
    mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
    avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
    vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd
    lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
    gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
    eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
    nidplktadlaeklfklsrgryglplssrpvvksmmsnknlrgkscnsivdciswlevfc
    aeltsriqdleqeynkiviprtvsislktksyevyrksgpvaykginfqshellkvgikf
    vtdldikgknksyypltklsmtitnfdiidlqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jihB (B:)
    mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
    avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
    vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd
    lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
    gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
    eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
    nidplktadlaeklfklsrgryglplssrpvvksmmsnknlrgkscnsivdciswlevfc
    aeltsriqdleqeynkiviprtvsislktksyevyrksgpvaykginfqshellkvgikf
    vtdldikgknksyypltklsmtitnfdii