PDB entry 1jih

View 1jih on RCSB PDB site
Description: Yeast DNA Polymerase ETA
Deposited on 2001-07-02, released 2002-01-09
The last revision prior to the SCOP 1.65 freeze date was dated 2002-01-09, with a file datestamp of 2002-01-09.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.215
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1jiha_
  • Chain 'B':
    Domains in SCOP 1.65: d1jihb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jihA (A:)
    mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
    avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
    vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd
    lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
    gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
    eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
    nidplktadlaeklfklsrgryglplssrpvvksmmsnknlrgkscnsivdciswlevfc
    aeltsriqdleqeynkiviprtvsislktksyevyrksgpvaykginfqshellkvgikf
    vtdldikgknksyypltklsmtitnfdiidlqktvvdmfgnqvhtfkssag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jihA (A:)
    mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
    avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
    vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd
    lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
    gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
    eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
    nidplktadlaeklfklsrgryglplssrpvvksmmsnknlrgkscnsivdciswlevfc
    aeltsriqdleqeynkiviprtvsislktksyevyrksgpvaykginfqshellkvgikf
    vtdldikgknksyypltklsmtitnfdii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jihB (B:)
    mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
    avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
    vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd
    lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
    gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
    eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
    nidplktadlaeklfklsrgryglplssrpvvksmmsnknlrgkscnsivdciswlevfc
    aeltsriqdleqeynkiviprtvsislktksyevyrksgpvaykginfqshellkvgikf
    vtdldikgknksyypltklsmtitnfdiidlqktvvdmfgnqvhtfkssag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jihB (B:)
    mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
    avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
    vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd
    lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
    gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
    eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
    nidplktadlaeklfklsrgryglplssrpvvksmmsnknlrgkscnsivdciswlevfc
    aeltsriqdleqeynkiviprtvsislktksyevyrksgpvaykginfqshellkvgikf
    vtdldikgknksyypltklsmtitnfdii