PDB entry 1jib

View 1jib on RCSB PDB site
Description: Complex of Alpha-amylase II (TVA II) from Thermoactinomyces vulgaris R-47 with Maltotetraose Based on a Crystal Soaked with Maltohexaose.
Class: hydrolase
Keywords: pullulan, cyclodextrin, neopullulanase, maltohexaose, maltotetraose, HYDROLASE
Deposited on 2001-07-02, released 2001-07-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.212
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neopullulanase
    Species: Thermoactinomyces vulgaris [TaxId:2026]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08751 (0-584)
      • engineered (324)
    Domains in SCOPe 2.06: d1jiba1, d1jiba2, d1jiba3
  • Chain 'B':
    Compound: neopullulanase
    Species: Thermoactinomyces vulgaris [TaxId:2026]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08751 (0-584)
      • engineered (324)
    Domains in SCOPe 2.06: d1jibb1, d1jibb2, d1jibb3
  • Heterogens: MTT

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jibA (A:)
    mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
    gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
    vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
    yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
    vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
    pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas
    gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
    dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
    rglfefykelirlrhrlasltrgnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqt
    vllqvpesggktwldcltgeevhgkqgqlkltlrpyqgmilwngr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jibB (B:)
    mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
    gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
    vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
    yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
    vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
    pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas
    gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
    dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
    rglfefykelirlrhrlasltrgnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqt
    vllqvpesggktwldcltgeevhgkqgqlkltlrpyqgmilwngr