PDB entry 1jia

View 1jia on RCSB PDB site
Description: structure of a basic phospholipase a2 from agkistrodon halys pallas at 2.13a resolution
Class: phospholipase
Keywords: phospholipase a2, agkistrodon halys pallas crystal structure
Deposited on 1997-06-09, released 1998-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.152
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Gloydius halys [TaxId:8714]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O42187 (0-121)
    • conflict (18)
    • conflict (57)
    • conflict (71)
    • conflict (84)
    • conflict (89)
  Domains in SCOPe 2.08: d1jiaa_
• Chain 'B':
  Compound: phospholipase a2
  Species: Gloydius halys [TaxId:8714]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O42187 (0-121)
    • conflict (18)
    • conflict (57)
    • conflict (71)
    • conflict (84)
    • conflict (89)
  Domains in SCOPe 2.08: d1jiab_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jiaA (A:)
  hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
  wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
  kc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jiaB (B:)
  hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
  wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
  kc