PDB entry 1ji6

View 1ji6 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF THE INSECTICIDAL BACTERIAL DEL ENDOTOXIN CRY3Bb1 BACILLUS THURINGIENSIS
Class: toxin
Keywords: Cry3Bb1, TOXIN
Deposited on 2001-06-29, released 2001-09-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.175
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pesticidial crystal protein cry3bb
    Species: Bacillus thuringiensis [TaxId:1428]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ji6a1, d1ji6a2, d1ji6a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji6A (A:)
    davgtgisvvgqilgvvgvpfagaltsfyqsflntiwpsdadpwkafmaqvevlidkkie
    eyakskalaelqglqnnfedyvnalnswkktplslrskrsqdrirelfsqaeshfrnsmp
    sfavskfevlflptyaqaanthllllkdaqvfgeewgyssedvaefyhrqlkltqqytdh
    cvnwynvglnglrgstydawvkfnrfrremtltvldlivlfpfydirlyskgvkteltrd
    iftdpifslntlqeygptflsiensirkphlfdylqgiefhtrlqpgyfgkdsfnywsgn
    yvetrpsigssktitspfygdkstepvqklsfdgqkvyrtiantdvaawpngkvylgvtk
    vdfsqyddqknetstqtydskrnnghvsaqdsidqlppettdeplekayshqlnyaecfl
    mqdrrgtipfftwthrsvdffntidaekitqlpvvkayalssgasiiegpgftggnllfl
    kessnsiakfkvtlnsaallqryrvriryasttnlrlfvqnsnndflviyinktmnkddd
    ltyqtfdlattnsnmgfsgdkneliigaesfvsnekiyidkiefipvql