PDB entry 1ji5

View 1ji5 on RCSB PDB site
Description: Dlp-1 from bacillus anthracis
Class: metal transport
Keywords: dodecamer, four-helix bundle
Deposited on 2001-06-29, released 2002-06-19
The last revision prior to the SCOP 1.75 freeze date was dated 2002-06-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dlp-1
    Species: Bacillus anthracis
    Gene: dlp-1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ji5a_
  • Chain 'B':
    Compound: Dlp-1
    Species: Bacillus anthracis
    Gene: dlp-1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ji5b_
  • Chain 'C':
    Compound: Dlp-1
    Species: Bacillus anthracis
    Gene: dlp-1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ji5c_
  • Chain 'D':
    Compound: Dlp-1
    Species: Bacillus anthracis
    Gene: dlp-1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ji5d_
  • Heterogens: FE, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji5A (A:)
    qvievlnkqvadwsvlftklhnfhwyvkgpqfftlhekfeelytesathideiaerilai
    ggkpvatmkeyleissiqeaaygetaegmveaimkdyemmlvelkkgmeiaqnsddemts
    dlllgiytelekhawmlrafln
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji5B (B:)
    qvievlnkqvadwsvlftklhnfhwyvkgpqfftlhekfeelytesathideiaerilai
    ggkpvatmkeyleissiqeaaygetaegmveaimkdyemmlvelkkgmeiaqnsddemts
    dlllgiytelekhawmlrafln
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji5C (C:)
    qvievlnkqvadwsvlftklhnfhwyvkgpqfftlhekfeelytesathideiaerilai
    ggkpvatmkeyleissiqeaaygetaegmveaimkdyemmlvelkkgmeiaqnsddemts
    dlllgiytelekhawmlrafln
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji5D (D:)
    qvievlnkqvadwsvlftklhnfhwyvkgpqfftlhekfeelytesathideiaerilai
    ggkpvatmkeyleissiqeaaygetaegmveaimkdyemmlvelkkgmeiaqnsddemts
    dlllgiytelekhawmlrafln