PDB entry 1jhz

View 1jhz on RCSB PDB site
Description: Purine Repressor Mutant Corepressor Binding Domain Structure
Class: transcription
Keywords: corepressor binding domain, purine repressor, allosteric regulation, DNA-binding protein, purine biosynthesis, TRANSCRIPTION
Deposited on 2001-06-28, released 2002-02-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.178
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleotide synthesis repressor
    Species: Escherichia coli [TaxId:562]
    Gene: PURR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACP7 (Start-288)
      • engineered (94)
    Domains in SCOPe 2.06: d1jhza_
  • Chain 'B':
    Compound: purine nucleotide synthesis repressor
    Species: Escherichia coli [TaxId:562]
    Gene: PURR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACP7 (Start-288)
      • engineered (94)
    Domains in SCOPe 2.06: d1jhzb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jhzA (A:)
    slkvnhtksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmma
    qkrvdgllvmcseypepllamleeyrhipmvvmdfgeakadftdavidnafeggymagry
    lierghreigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqq
    ilsqphrptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihq
    pkdslgetafnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jhzA (A:)
    ksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgl
    lvmcseypepllamleeyrhipmvvmdfgeakadftdavidnafeggymagrylierghr
    eigvipgpagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrptavfc
    ggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgetafnml
    ldrivnkreepqsievhprlierrsvadgpfrdyrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jhzB (B:)
    slkvnhtksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmma
    qkrvdgllvmcseypepllamleeyrhipmvvmdfgeakadftdavidnafeggymagry
    lierghreigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqq
    ilsqphrptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihq
    pkdslgetafnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jhzB (B:)
    ksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgl
    lvmcseypepllamleeyrhipmvvmdfgeakadftdavidnafeggymagrylierghr
    eigvipgpagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrptavfc
    ggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgetafnml
    ldrivnkreepqsievhprlierrsvadgpfrdyrr