PDB entry 1jhl

View 1jhl on RCSB PDB site
Description: three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex
Deposited on 1993-05-04, released 1994-01-31
The last revision prior to the SCOP 1.65 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.214
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1jhla_
  • Chain 'H':
    Domains in SCOP 1.65: d1jhlh_
  • Chain 'L':
    Domains in SCOP 1.65: d1jhll_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jhlA (A:)
    kvygrcelaaamkrmgldnyrgyslgnwvcaakfesnfntgatnrntdgstdygilqins
    rwwcndgrtpgsknlchipcsallssditasvncakkivsdgdgmnawvawrkhckgtdv
    nvwirgcrl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jhlH (H:)
    qvqlqqsgaelvrpgasvklsckasgytfisywinwvkqrpgqglewigniypsdsytny
    nqkfkdkatltvdkssstaymqlssptsedsavyyctrddnygamdywgqgttvtv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jhlL (L:)
    dieltqspsylvaspgetitincrasksiskslawyqekpgktnnlliysgstlqsgips
    rfsgsgsgtdftltisslepedfamyicqqhneypwtfgggtkleikr