PDB entry 1jhk

View 1jhk on RCSB PDB site
Description: Crystal structure of the anti-estradiol antibody 57-2
Deposited on 2001-06-28, released 2001-10-10
The last revision prior to the SCOP 1.63 freeze date was dated 2001-10-10, with a file datestamp of 2001-10-10.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.198
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jhkH (H:)
    iqlvqsgpelkkpgetvrisckasdysfmtsgmqwvqqmpgkglkwigwlntqsgvpeya
    edfkgrfafsletsattaylqinnlknedtatyfcatwggnsaywgqgttltvssakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jhkH (H:)
    iqlvqsgpelkkpgetvrisckasdytsgmqwvqqmpgkglkwigwlntqsgvpeyaedf
    kgrfafslettaylqinnlknedtatyfcatwggnsaywgqgttltvssakttppsvypl
    apgtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvpsstw
    psetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jhkL (L:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgtyychhfwstpwtfgggtklevkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne