PDB entry 1jhd

View 1jhd on RCSB PDB site
Description: Crystal Structure of Bacterial ATP Sulfurylase from the Riftia pachyptila Symbiont
Class: transferase
Keywords: adenylyl transferase, sulfurylase, aps, chemoautotroph, bromide
Deposited on 2001-06-27, released 2001-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.167
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfate adenylyltransferase
    Species: Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId:35843]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jhda1, d1jhda2
  • Heterogens: SO4, BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jhdA (A:)
    mikpvgsdelkplfvydpeehhklsheaeslpsvvissqaagnavmmgagyfsplqgfmn
    vadamgaaekmtlsdgsffpvpvlcllentdaigdakrialrdpnvegnpvlavmdieai
    eevsdeqmavmtdkvyrttdmdhigvktfnsqgrvavsgpiqvlnfsyfqadfpdtfrta
    veirneikehgwskvvafqtrnpmhraheelcrmamesldadgvvvhmllgklkkgdipa
    pvrdaairtmaevyfppntvmvtgygfdmlyagpreavlhayfrqnmgathfiigrdhag
    vgdyygafdaqtifddevpegameieifradhtayskklnkivmmrdvpdhtkedfvlls
    gtkvremlgqgiapppefsrpevakilmdyyqsins