PDB entry 1jhd

View 1jhd on RCSB PDB site
Description: Crystal Structure of Bacterial ATP Sulfurylase from the Riftia pachyptila Symbiont
Deposited on 2001-06-27, released 2001-12-07
The last revision prior to the SCOP 1.61 freeze date was dated 2001-12-07, with a file datestamp of 2001-12-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.167
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jhdA (A:)
    mikpvgsdelkplfvydpeehhklsheaeslpsvvissqaagnavmmgagyfsplqgfmn
    vadamgaaekmtlsdgsffpvpvlcllentdaigdakrialrdpnvegnpvlavmdieai
    eevsdeqmavmtdkvyrttdmdhigvktfnsqgrvavsgpiqvlnfsyfqadfpdtfrta
    veirneikehgwskvvafqtrnpmhraheelcrmamesldadgvvvhmllgklkkgdipa
    pvrdaairtmaevyfppntvmvtgygfdmlyagpreavlhayfrqnmgathfiigrdhag
    vgdyygafdaqtifddevpegameieifradhtayskklnkivmmrdvpdhtkedfvlls
    gtkvremlgqgiapppefsrpevakilmdyyqsins