PDB entry 1jh4

View 1jh4 on RCSB PDB site
Description: Solution structure of the C-terminal PABC domain of human poly(A)-binding protein in complex with the peptide from Paip1
Class: RNA binding protein
Keywords: all-helical domain, protein-peptide complex, RNA BINDING PROTEIN
Deposited on 2001-06-27, released 2003-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polyadenylate-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PABPC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11940 (5-97)
      • cloning artifact (0-4)
    Domains in SCOPe 2.07: d1jh4a1, d1jh4a2
  • Chain 'B':
    Compound: polyadenylate-binding protein-interacting protein-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jh4A (A:)
gplgspltasmlasappqeqkqmlgerlfpliqamhptlagkitgmlleidnsellhmle
speslrskvdeavavlqahqakeaaqkavnsatgvptv

  • Chain 'B':
    No sequence available.