PDB entry 1jh3

View 1jh3 on RCSB PDB site
Description: solution structure of tyrosyl-trna synthetase c-terminal domain.
Deposited on 2001-06-27, released 2002-03-20
The last revision prior to the SCOP 1.63 freeze date was dated 2002-03-20, with a file datestamp of 2002-03-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1jh3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jh3A (A:)
    alfsgdianltaaeieqgfkdvpsfvheggdvplvellvsagispskrqarediqngaiy
    vngerlqdvgailtaehrlegrftvirrgkkkyylirya