PDB entry 1jgv

View 1jgv on RCSB PDB site
Description: structural basis for disfavored elimination reaction in catalytic antibody 1d4
Class: immune system
Keywords: IgG fold
Deposited on 2001-06-26, released 2001-12-05
The last revision prior to the SCOP 1.73 freeze date was dated 2001-12-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.206
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antibody heavy chain
    Species: Mus musculus
    Domains in SCOP 1.73: d1jgvh1, d1jgvh2
  • Chain 'L':
    Compound: Antibody Light Chain
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAA67525 (0-End)
      • see remark 999 (0)
      • see remark 999 (28)
      • see remark 999 (38)
      • see remark 999 (91)
      • see remark 999 (93)
      • see remark 999 (95)
      • see remark 999 (102)
      • see remark 999 (101)
      • see remark 999 (105)
      • see remark 999 (108)
      • see remark 999 (111)
    Domains in SCOP 1.73: d1jgvl1, d1jgvl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jgvH (H:)
    evklvesrgglvkpggslqlscaasgftfsgyamswfrltpekrlewvasiyngfrihyl
    dsvkgrftissdyarnilylqmstlrsedtamyycsrgdaysryfdvwgagttvtvsaak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jgvL (L:)
    evvmtqsplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvppltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec