PDB entry 1jgl

View 1jgl on RCSB PDB site
Description: Crystal structure of immunoglobulin Fab fragment complexed with 17-beta-estradiol
Deposited on 2001-06-26, released 2001-10-10
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-10, with a file datestamp of 2001-10-10.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jglH (H:)
    qiqlvqsgpelkkpgetvrisckasdysfmtsgmqwvqqmpgkglkwigwlntqsgvpey
    aedfkgrfafsletsattaylqinnlknedtatyfcatwggnsaywgqgttltvssaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jglH (H:)
    qiqlvqsgpelkkpgetvrisckasdymtsgmqwvqqmpgkglkwigwlntqsgvpeyae
    dfkgrfafslettaylqinnlknedtatyfcatwggnsaywgqgttltvssakttppsvy
    plapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvpsst
    wpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jglL (L:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgtyychhfwstpwtfgggtklevkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne