PDB entry 1jgj

View 1jgj on RCSB PDB site
Description: crystal structure of sensory rhodopsin II at 2.4 angstroms: insights into color tuning and transducer interaction
Class: signaling protein
Keywords: sensory rhodopsin, membrane protein, phototaxis receptor, signaling protein
Deposited on 2001-06-25, released 2001-07-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sensory rhodopsin II
  Species: Natronomonas pharaonis [TaxId:2257]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42196 (0-216)
    • conflict (51)
    • conflict (69)
    • conflict (134)
    • conflict (168)
  Domains in SCOPe 2.08: d1jgja_
• Heterogens: BOG, RET, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jgjA (A:)
  mvglttlfwlgaigmlvgtlafawagrdagsgerryyvtlvgisgiaavayavmalgvgw
  vpvaertvfvpryidwilttplivyflgllagldsrefgivitlntvvmlagfagamvpg
  ieryalfgmgavafiglvyylvgpmtesasqrssgikslyvrlrnltvvlwaiypfiwll
  gppgvalltptvdvalivyldlvtkvgfgfialdaaa