PDB entry 1jgc

View 1jgc on RCSB PDB site
Description: The 2.6 A Structure Resolution of Rhodobacter capsulatus Bacterioferritin with Metal-free Dinuclear Site and Heme Iron in a Crystallographic Special Position
Class: metal binding protein
Keywords: Iron storage protein, METAL BINDING PROTEIN
Deposited on 2001-06-24, released 2002-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.225
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jgca_
  • Chain 'B':
    Compound: bacterioferritin
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jgcb_
  • Chain 'C':
    Compound: bacterioferritin
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jgcc_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jgcA (A:)
    mkgdakvieflnaalrseltaisqywvhfrlqedwglakmakksreesieemghadkiia
    rilfleghpnlqkldplrigegpretlecdlagehdalklyreardycaevgdivsknif
    eslitdeeghvdfletqislydrlgpqgfallnaapmdaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jgcA (A:)
    mkgdakvieflnaalrseltaisqywvhfrlqedwglakmakksreesieemghadkiia
    rilfleghpnlqkldplrigegpretlecdlagehdalklyreardycaevgdivsknif
    eslitdeeghvdfletqislydrlgpqgfallnaapmdaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jgcB (B:)
    mkgdakvieflnaalrseltaisqywvhfrlqedwglakmakksreesieemghadkiia
    rilfleghpnlqkldplrigegpretlecdlagehdalklyreardycaevgdivsknif
    eslitdeeghvdfletqislydrlgpqgfallnaapmdaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jgcB (B:)
    mkgdakvieflnaalrseltaisqywvhfrlqedwglakmakksreesieemghadkiia
    rilfleghpnlqkldplrigegpretlecdlagehdalklyreardycaevgdivsknif
    eslitdeeghvdfletqislydrlgpqgfallnaapmdaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jgcC (C:)
    mkgdakvieflnaalrseltaisqywvhfrlqedwglakmakksreesieemghadkiia
    rilfleghpnlqkldplrigegpretlecdlagehdalklyreardycaevgdivsknif
    eslitdeeghvdfletqislydrlgpqgfallnaapmdaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jgcC (C:)
    mkgdakvieflnaalrseltaisqywvhfrlqedwglakmakksreesieemghadkiia
    rilfleghpnlqkldplrigegpretlecdlagehdalklyreardycaevgdivsknif
    eslitdeeghvdfletqislydrlgpqgfallnaapmdaa