PDB entry 1jfx

View 1jfx on RCSB PDB site
Description: Crystal structure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution
Class: hydrolase
Keywords: beta-alpha-barrel, Cellosyl, lysozyme, N-acetylmuramidase, HYDROLASE
Deposited on 2001-06-22, released 2001-09-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.152
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-beta-N-Acetylmuramidase M1
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: cel
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jfxa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfxA (A:)
    dtsgvqgidvshwqgsinwssvksagmsfayikategtnykddrfsanytnaynagiirg
    ayhfarpnassgtaqadyfasngggwsrdnrtlpgvldiehnpsgamcyglsttqmrtwi
    ndfharykarttrdvviyttaswwntctgswngmaakspfwvahwgvsaptvpsgfptwt
    fwqysatgrvggvsgdvdrnkfngsaarllalannta